PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877752.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 290aa    MW: 32052.8 Da    PI: 7.4349
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877752.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.53.9e-42141131100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++rrkC+++C++apyfp +qp+kf nvh+++Gasnv kll++l+  +reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l 
  XP_015877752.1  14 PCAACKFQRRKCTQECIFAPYFPPDQPQKFTNVHRVYGASNVAKLLNELNSVHREDAVTSLAYEAEARLRDPVYGCVGFISILQNRLRQVQSDLY 108
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k+e
  XP_015877752.1 109 AAKKE 113
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.23813114IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4114111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MSLSSSSSSS SHSPCAACKF QRRKCTQECI FAPYFPPDQP QKFTNVHRVY GASNVAKLLN  60
ELNSVHREDA VTSLAYEAEA RLRDPVYGCV GFISILQNRL RQVQSDLYAA KKELAAYIGP  120
QAMMIQPQPQ HAAAADYNIN MNMSMPMPML GIPTGPSQGS GGGGDHLLIR DSHLQQQQMY  180
EAQPQQQQQQ ELVRYNSSSG GFDPVSTLGR GGGFNNHQMG GNGNTSAMNN MSPSLGLGIF  240
DQNVCQIHQP PAQYHHPIEY HQIQAQLLPY QQPQQLHHSH HKSVPDDSQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877752.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-68LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J87e-80M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t016e-78(Vitis vinifera)
STRINGVIT_07s0197g00030.t015e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-62ASYMMETRIC LEAVES 2-like 1